PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA40G00325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 315aa    MW: 35728.5 Da    PI: 9.7743
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA40G00325genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1679124147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
       AA40G00325  79 RGHWRPTEDAKLKELVAQFGPQNWNLIAHHLL-GRSGKSCRLRWFNQ 124
                      899****************************9.***********996 PP

2Myb_DNA-binding52.98.7e-17132174246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+ +l+ a+k +G++ W++I+r ++ gRt++ +k++w+ 
       AA40G00325 132 RAFTEEEEIKLLSAHKAYGNK-WALISRLFP-GRTDNAVKNHWHV 174
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.84574125IPR017930Myb domain
SMARTSM007173.4E-1478127IPR001005SANT/Myb domain
SuperFamilySSF466891.46E-2879172IPR009057Homeodomain-like
PfamPF002496.5E-1679124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2580132IPR009057Homeodomain-like
CDDcd001671.53E-1282123No hitNo description
PROSITE profilePS5129424.764126180IPR017930Myb domain
SMARTSM007178.2E-15130178IPR001005SANT/Myb domain
PfamPF002492.1E-14132173IPR001005SANT/Myb domain
CDDcd001675.51E-11133173No hitNo description
Gene3DG3DSA:1.10.10.602.8E-20133179IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MNLNLLNKDL KGKETINEET ITVSYKTSLI NLSLSRNNLH DKSVSILGSR SEKEKVGVQN  60
ENIFKKKGRN GIHTKICSRG HWRPTEDAKL KELVAQFGPQ NWNLIAHHLL GRSGKSCRLR  120
WFNQLDPRIN KRAFTEEEEI KLLSAHKAYG NKWALISRLF PGRTDNAVKN HWHVIMARRT  180
RESQRKSQQL QHVPSPLPSV DAEMTVSSSC HYNEAEGSLV NDDDDGSAVS TCTTELSLTP  240
SSLVLQPRLF NYDNALLPSG EDGQCMQRAA VKGKYGKKKL DHQNQETITV NDIEKMKMKT  300
NNGFYFFDFL GVGFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-32791807108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871782.11e-151AtMYB56
TrEMBLA0A087G8031e-155A0A087G803_ARAAL; Uncharacterized protein
STRINGfgenesh2_kg.6__1780__AT5G17800.11e-150(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-140myb domain protein 56